Anti DDIT4 pAb (ATL-HPA034508)

Atlas Antibodies

Catalog No.: ATL-HPA034508-25

Protein Description: DNA-damage-inducible transcript 4
Gene Name: DDIT4
Alternative Gene Name: Dig2, FLJ20500, REDD-1, REDD1, RTP801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020108: 97%, ENSRNOG00000057078: 97%
Entrez Gene ID: 54541
Uniprot ID: Q9NX09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD
• Gene Sequence: QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD
• Gene ID - Mouse: ENSMUSG00000020108
• Gene ID - Rat: ENSRNOG00000057078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DDIT4 pAb (ATL-HPA034508) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.