Anti DDA1 pAb (ATL-HPA042134)

Atlas Antibodies

Catalog No.: ATL-HPA042134-25

Protein Description: DET1 and DDB1 associated 1
Gene Name: DDA1
Alternative Gene Name: C19orf58, MGC2594, PCIA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074247: 99%, ENSRNOG00000039417: 99%
Entrez Gene ID: 79016
Uniprot ID: Q9BW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
• Gene Sequence: LKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
• Gene ID - Mouse: ENSMUSG00000074247
• Gene ID - Rat: ENSRNOG00000039417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.