Anti DCX pAb (ATL-HPA036121)

Atlas Antibodies

Catalog No.: ATL-HPA036121-25

Protein Description: doublecortin
Gene Name: DCX
Alternative Gene Name: DBCN, DC, LISX, SCLH, XLIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 99%, ENSRNOG00000047712: 94%
Entrez Gene ID: 1641
Uniprot ID: O43602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTS
• Gene Sequence: KFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTS
• Gene ID - Mouse: ENSMUSG00000031285
• Gene ID - Rat: ENSRNOG00000047712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.