Anti DCTN6 pAb (ATL-HPA024049 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024049-100

Protein Description: dynactin 6
Gene Name: DCTN6
Alternative Gene Name: WS-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031516: 98%, ENSRNOG00000013254: 98%
Entrez Gene ID: 10671
Uniprot ID: O00399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
• Gene Sequence: NNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
• Gene ID - Mouse: ENSMUSG00000031516
• Gene ID - Rat: ENSRNOG00000013254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.