Anti DBNL pAb (ATL-HPA020265 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020265-100

Protein Description: drebrin-like
Gene Name: DBNL
Alternative Gene Name: HIP-55, SH3P7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020476: 95%, ENSRNOG00000012378: 95%
Entrez Gene ID: 28988
Uniprot ID: Q9UJU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
• Gene Sequence: INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
• Gene ID - Mouse: ENSMUSG00000020476
• Gene ID - Rat: ENSRNOG00000012378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.