Anti DBN1 pAb (ATL-HPA051452 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA051452-25

Protein Description: drebrin 1
Gene Name: DBN1
Alternative Gene Name: D0S117E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034675: 61%, ENSRNOG00000014170: 61%
Entrez Gene ID: 1627
Uniprot ID: Q16643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
• Gene Sequence: PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
• Gene ID - Mouse: ENSMUSG00000034675
• Gene ID - Rat: ENSRNOG00000014170
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.