Anti DBH pAb (ATL-HPA002130 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002130-25

Protein Description: dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Gene Name: DBH
Alternative Gene Name: DBM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000889: 72%, ENSRNOG00000006641: 70%
Entrez Gene ID: 1621
Uniprot ID: P09172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
• Gene Sequence: VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
• Gene ID - Mouse: ENSMUSG00000000889
• Gene ID - Rat: ENSRNOG00000006641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.