Anti DAZL pAb (ATL-HPA019593 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019593-100

• 
• 

Protein Description: deleted in azoospermia-like
Gene Name: DAZL
Alternative Gene Name: DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010592: 84%, ENSRNOG00000023474: 84%
Entrez Gene ID: 1618
Uniprot ID: Q92904
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS
• Gene Sequence: PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS
• Gene ID - Mouse: ENSMUSG00000010592
• Gene ID - Rat: ENSRNOG00000023474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.