Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004201-25
Immunohistochemistry analysis in human testis and liver tissues using HPA004201 antibody. Corresponding DAZAP1 RNA-seq data are presented for the same tissues.
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DAZ associated protein 1
Gene Name: DAZAP1
Alternative Gene Name: MGC19907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069565: 98%, ENSRNOG00000031387: 98%
Entrez Gene ID: 26528
Uniprot ID: Q96EP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
Gene Sequence EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
Gene ID - Mouse ENSMUSG00000069565
Gene ID - Rat ENSRNOG00000031387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation)
Datasheet Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation)
Datasheet Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation)
Citations for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) – 1 Found
Buratti, Emanuele; Peruzzo, Paolo; Braga, Luca; Zanin, Irene; Stuani, Cristiana; Goina, Elisa; Romano, Maurizio; Giacca, Mauro; Dardis, Andrea. Deferoxamine mesylate improves splicing and GAA activity of the common c.-32-13T>G allele in late-onset PD patient fibroblasts. Molecular Therapy. Methods & Clinical Development. 2021;20( 33426149):227-236.  PubMed
!