Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004201-25

• 
• 
• 

Protein Description: DAZ associated protein 1
Gene Name: DAZAP1
Alternative Gene Name: MGC19907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069565: 98%, ENSRNOG00000031387: 98%
Entrez Gene ID: 26528
Uniprot ID: Q96EP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
• Gene Sequence: EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
• Gene ID - Mouse: ENSMUSG00000069565
• Gene ID - Rat: ENSRNOG00000031387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DAZAP1 pAb (ATL-HPA004201 w/enhanced validation) – 1 Found

Buratti, Emanuele; Peruzzo, Paolo; Braga, Luca; Zanin, Irene; Stuani, Cristiana; Goina, Elisa; Romano, Maurizio; Giacca, Mauro; Dardis, Andrea. Deferoxamine mesylate improves splicing and GAA activity of the common c.-32-13T>G allele in late-onset PD patient fibroblasts. Molecular Therapy. Methods & Clinical Development. 2021;20( 33426149):227-236.