Anti DACT3 pAb (ATL-HPA043053)

Atlas Antibodies

Catalog No.: ATL-HPA043053-25

Protein Description: dishevelled-binding antagonist of beta-catenin 3
Gene Name: DACT3
Alternative Gene Name: DAPPER3, MGC15476, RRR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078794: 95%, ENSRNOG00000052256: 95%
Entrez Gene ID: 147906
Uniprot ID: Q96B18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEP
• Gene Sequence: ALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEP
• Gene ID - Mouse: ENSMUSG00000078794
• Gene ID - Rat: ENSRNOG00000052256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.