Anti DAAM1 pAb (ATL-HPA064789)

Atlas Antibodies

Catalog No.: ATL-HPA064789-25

Protein Description: dishevelled associated activator of morphogenesis 1
Gene Name: DAAM1
Alternative Gene Name: KIAA0666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034574: 100%, ENSRNOG00000004345: 100%
Entrez Gene ID: 23002
Uniprot ID: Q9Y4D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSE
• Gene Sequence: APRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSE
• Gene ID - Mouse: ENSMUSG00000034574
• Gene ID - Rat: ENSRNOG00000004345
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.