Anti CYP2S1 pAb (ATL-HPA069248)

Atlas Antibodies

Catalog No.: ATL-HPA069248-25

Protein Description: cytochrome P450 family 2 subfamily S member 1
Gene Name: CYP2S1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040703: 82%, ENSRNOG00000020743: 80%
Entrez Gene ID: 29785
Uniprot ID: Q96SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
• Gene Sequence: GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
• Gene ID - Mouse: ENSMUSG00000040703
• Gene ID - Rat: ENSRNOG00000020743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.