Anti CYP2D6 pAb (ATL-HPA045223 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045223-25

Protein Description: cytochrome P450, family 2, subfamily D, polypeptide 6
Gene Name: CYP2D6
Alternative Gene Name: CPD6, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, P450-DB1, P450C2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061740: 65%, ENSRNOG00000032261: 68%
Entrez Gene ID: 1565
Uniprot ID: P10635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
• Gene Sequence: EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
• Gene ID - Mouse: ENSMUSG00000061740
• Gene ID - Rat: ENSRNOG00000032261
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.