Anti-CYLD pAb (ATL-HPA077163)

Atlas Antibodies

Catalog No.:
ATL-HPA077163-100
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Polyclonal Antibody against Human CYLD, Gene description: CYLD lysine 63 deubiquitinase, Alternative Gene Names: CYLD1, KIAA0849, USPL2, Validated applications: IHC, WB, Uniprot ID: Q9NQC7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQ
Gene Sequence FVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQ
Gene ID - Mouse ENSMUSG00000036712
Gene ID - Rat ENSRNOG00000014048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-CYLD pAb (ATL-HPA077163)
Vendor Page Anti-CYLD pAb (ATL-HPA077163) at Atlas Antibodies

Documents & Links for Anti-CYLD pAb (ATL-HPA077163)
Vendor Page Anti-CYLD pAb (ATL-HPA077163)
!