Anti CYHR1 pAb (ATL-HPA059543)

Atlas Antibodies

Catalog No.: ATL-HPA059543-100

Protein Description: cysteine/histidine-rich 1
Gene Name: CYHR1
Alternative Gene Name: CHRP, KIAA0496, MGC13010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053929: 98%, ENSRNOG00000014811: 98%
Entrez Gene ID: 50626
Uniprot ID: Q6ZMK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT
• Gene Sequence: ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT
• Gene ID - Mouse: ENSMUSG00000053929
• Gene ID - Rat: ENSRNOG00000014811
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.