Anti CXorf58 pAb (ATL-HPA031543)

Atlas Antibodies

Catalog No.: ATL-HPA031543-25

Protein Description: chromosome X open reading frame 58
Gene Name: CXorf58
Alternative Gene Name: FLJ25444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018581: 27%, ENSRNOG00000005451: 27%
Entrez Gene ID: 254158
Uniprot ID: Q96LI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDER
• Gene Sequence: THEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDER
• Gene ID - Mouse: ENSMUSG00000018581
• Gene ID - Rat: ENSRNOG00000005451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.