Anti CXorf56 pAb (ATL-HPA064831)

Atlas Antibodies

Catalog No.: ATL-HPA064831-100

Protein Description: chromosome X open reading frame 56
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
• Gene Sequence: MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
• Gene ID - Mouse: ENSMUSG00000006423
• Gene ID - Rat: ENSRNOG00000012564
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.