Anti CXCR3 pAb (ATL-HPA045942 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045942-25

Protein Description: chemokine (C-X-C motif) receptor 3
Gene Name: CXCR3
Alternative Gene Name: CD183, CKR-L2, CMKAR3, GPR9, IP10-R, MigR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050232: 67%, ENSRNOG00000003305: 67%
Entrez Gene ID: 2833
Uniprot ID: P49682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
• Gene Sequence: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
• Gene ID - Mouse: ENSMUSG00000050232
• Gene ID - Rat: ENSRNOG00000003305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.