Anti CXCR2 pAb (ATL-HPA031999 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031999-25

Protein Description: chemokine (C-X-C motif) receptor 2
Gene Name: CXCR2
Alternative Gene Name: CD182, CMKAR2, IL8RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026180: 46%, ENSRNOG00000014269: 43%
Entrez Gene ID: 3579
Uniprot ID: P25025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK
• Gene Sequence: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK
• Gene ID - Mouse: ENSMUSG00000026180
• Gene ID - Rat: ENSRNOG00000014269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CXCR2 pAb (ATL-HPA031999 w/enhanced validation) – 1 Found

Boissière-Michot, Florence; Jacot, William; Fraisse, Julien; Gourgou, Sophie; Timaxian, Colin; Lazennec, Gwendal. Prognostic Value of CXCR2 in Breast Cancer. Cancers. 2020;12(8)