Anti CXADR pAb (ATL-HPA030412 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030412-25

Protein Description: coxsackie virus and adenovirus receptor
Gene Name: CXADR
Alternative Gene Name: CAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022865: 89%, ENSRNOG00000001557: 92%
Entrez Gene ID: 1525
Uniprot ID: P78310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK
• Gene Sequence: KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK
• Gene ID - Mouse: ENSMUSG00000022865
• Gene ID - Rat: ENSRNOG00000001557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.