Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA068479-25

Protein Description: CUB and zona pellucida-like domains 1
Gene Name: CUZD1
Alternative Gene Name: ERG-1, UO-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040205: 83%, ENSRNOG00000029945: 89%
Entrez Gene ID: 50624
Uniprot ID: Q86UP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL
• Gene Sequence: QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL
• Gene ID - Mouse: ENSMUSG00000040205
• Gene ID - Rat: ENSRNOG00000029945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.