Anti CTSK pAb (ATL-HPA050346)

Atlas Antibodies

Catalog No.: ATL-HPA050346-25

Protein Description: cathepsin K
Gene Name: CTSK
Alternative Gene Name: CTSO, CTSO2, PKND, PYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028111: 83%, ENSRNOG00000021155: 85%
Entrez Gene ID: 1513
Uniprot ID: P43235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
• Gene Sequence: LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
• Gene ID - Mouse: ENSMUSG00000028111
• Gene ID - Rat: ENSRNOG00000021155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.