Anti CSRP3 pAb (ATL-HPA042581 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042581-25

• 

Protein Description: cysteine and glycine-rich protein 3 (cardiac LIM protein)
Gene Name: CSRP3
Alternative Gene Name: CLP, CMD1M, MLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030470: 94%, ENSRNOG00000014327: 94%
Entrez Gene ID: 8048
Uniprot ID: P50461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
• Gene Sequence: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
• Gene ID - Mouse: ENSMUSG00000030470
• Gene ID - Rat: ENSRNOG00000014327
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.