Anti CSN1S1 pAb (ATL-HPA057031 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA057031-25

Protein Description: casein alpha s1
Gene Name: CSN1S1
Alternative Gene Name: CASA, CSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070702: 32%, ENSRNOG00000055596: 30%
Entrez Gene ID: 1446
Uniprot ID: P47710
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD
• Gene Sequence: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD
• Gene ID - Mouse: ENSMUSG00000070702
• Gene ID - Rat: ENSRNOG00000055596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.