Anti CSDC2 pAb (ATL-HPA003073 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA003073-100

• 
• 

Protein Description: cold shock domain containing C2, RNA binding
Gene Name: CSDC2
Alternative Gene Name: PIPPin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042109: 95%, ENSRNOG00000005332: 96%
Entrez Gene ID: 27254
Uniprot ID: Q9Y534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
• Gene Sequence: PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
• Gene ID - Mouse: ENSMUSG00000042109
• Gene ID - Rat: ENSRNOG00000005332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.