Anti CRYZL1 pAb (ATL-HPA019120 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019120-25

Protein Description: crystallin, zeta (quinone reductase)-like 1
Gene Name: CRYZL1
Alternative Gene Name: 4P11, QOH-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058240: 83%, ENSRNOG00000028014: 83%
Entrez Gene ID: 9946
Uniprot ID: O95825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLD
• Gene Sequence: MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLD
• Gene ID - Mouse: ENSMUSG00000058240
• Gene ID - Rat: ENSRNOG00000028014
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRYZL1 pAb (ATL-HPA019120 w/enhanced validation) – 1 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.