Anti CRISPLD2 pAb (ATL-HPA030054)

Atlas Antibodies

Catalog No.: ATL-HPA030054-25

Protein Description: cysteine rich secretory protein LCCL domain containing 2
Gene Name: CRISPLD2
Alternative Gene Name: DKFZP434B044, LCRISP2, LGL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031825: 78%, ENSRNOG00000016752: 78%
Entrez Gene ID: 83716
Uniprot ID: Q9H0B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK
• Gene Sequence: TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK
• Gene ID - Mouse: ENSMUSG00000031825
• Gene ID - Rat: ENSRNOG00000016752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.