Anti CRISPLD1 pAb (ATL-HPA024725)

Atlas Antibodies

SKU: ATL-HPA024725-25

• 

Protein Description: cysteine-rich secretory protein LCCL domain containing 1
Gene Name: CRISPLD1
Alternative Gene Name: Cocoacrisp, DKFZp762F133, LCRISP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025776: 96%, ENSRNOG00000017773: 92%
Entrez Gene ID: 83690
Uniprot ID: Q9H336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGC
• Gene Sequence: ACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGC
• Gene ID - Mouse: ENSMUSG00000025776
• Gene ID - Rat: ENSRNOG00000017773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.