Anti CR2 pAb (ATL-HPA060715 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA060715-25

Protein Description: complement component (3d/Epstein Barr virus) receptor 2
Gene Name: CR2
Alternative Gene Name: CD21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 58%, ENSRNOG00000034164: 56%
Entrez Gene ID: 1380
Uniprot ID: P20023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS
• Gene Sequence: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS
• Gene ID - Mouse: ENSMUSG00000026616
• Gene ID - Rat: ENSRNOG00000034164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.