Anti CPT2 pAb (ATL-HPA028202 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028202-25

• 
• 

Protein Description: carnitine palmitoyltransferase 2
Gene Name: CPT2
Alternative Gene Name: CPT1, CPTASE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028607: 85%, ENSRNOG00000012443: 83%
Entrez Gene ID: 1376
Uniprot ID: P23786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMVECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYP
• Gene Sequence: MMVECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYP
• Gene ID - Mouse: ENSMUSG00000028607
• Gene ID - Rat: ENSRNOG00000012443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.