Anti CPSF3 pAb (ATL-HPA034657)

Atlas Antibodies

Catalog No.: ATL-HPA034657-25

Protein Description: cleavage and polyadenylation specific factor 3, 73kDa
Gene Name: CPSF3
Alternative Gene Name: CPSF-73, CPSF73, YSH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054309: 95%, ENSRNOG00000052418: 95%
Entrez Gene ID: 51692
Uniprot ID: Q9UKF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
• Gene Sequence: PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
• Gene ID - Mouse: ENSMUSG00000054309
• Gene ID - Rat: ENSRNOG00000052418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.