Anti CPED1 pAb (ATL-HPA012058)

Atlas Antibodies

Catalog No.: ATL-HPA012058-25

Protein Description: cadherin-like and PC-esterase domain containing 1
Gene Name: CPED1
Alternative Gene Name: C7orf58, FLJ21986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062980: 62%, ENSRNOG00000021840: 57%
Entrez Gene ID: 79974
Uniprot ID: A4D0V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL
• Gene Sequence: GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL
• Gene ID - Mouse: ENSMUSG00000062980
• Gene ID - Rat: ENSRNOG00000021840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPED1 pAb (ATL-HPA012058) – 1 Found

Stadler, Charlotte; Fagerberg, Linn; Sivertsson, Åsa; Oksvold, Per; Zwahlen, Martin; Hallström, Björn M; Lundberg, Emma; Uhlén, Mathias. RNA- and antibody-based profiling of the human proteome with focus on chromosome 19. Journal Of Proteome Research. 2014;13(4):2019-27.