Anti CPEB3 pAb (ATL-HPA059056)

Atlas Antibodies

Catalog No.: ATL-HPA059056-25

Protein Description: cytoplasmic polyadenylation element binding protein 3
Gene Name: CPEB3
Alternative Gene Name: KIAA0940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111861: 100%, ENSRNOG00000020689: 65%
Entrez Gene ID: 22849
Uniprot ID: Q8NE35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNSRSSLFPFEDAFLDDSHGDQ
• Gene Sequence: FNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNSRSSLFPFEDAFLDDSHGDQ
• Gene ID - Mouse: ENSMUSG00000111861
• Gene ID - Rat: ENSRNOG00000020689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.