Anti COX8C pAb (ATL-HPA003127 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003127-100

Protein Description: cytochrome c oxidase subunit VIIIC
Gene Name: COX8C
Alternative Gene Name: COX8-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039633: 40%, ENSRNOG00000053945: 35%
Entrez Gene ID: 341947
Uniprot ID: Q7Z4L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
• Gene Sequence: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
• Gene ID - Mouse: ENSMUSG00000039633
• Gene ID - Rat: ENSRNOG00000053945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.