Anti COX6B1 pAb (ATL-HPA004192 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004192-25

Protein Description: cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
Gene Name: COX6B1
Alternative Gene Name: COX6B, COXG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036751: 84%, ENSRNOG00000034161: 84%
Entrez Gene ID: 1340
Uniprot ID: P14854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFP
• Gene Sequence: EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFP
• Gene ID - Mouse: ENSMUSG00000036751
• Gene ID - Rat: ENSRNOG00000034161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.