Anti COX5B pAb (ATL-HPA034517 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034517-25

Protein Description: cytochrome c oxidase subunit Vb
Gene Name: COX5B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061518: 87%, ENSRNOG00000016660: 84%
Entrez Gene ID: 1329
Uniprot ID: P10606
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP
• Gene Sequence: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP
• Gene ID - Mouse: ENSMUSG00000061518
• Gene ID - Rat: ENSRNOG00000016660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COX5B pAb (ATL-HPA034517 w/enhanced validation) – 1 Found

Rhein, Virginie F; Carroll, Joe; Ding, Shujing; Fearnley, Ian M; Walker, John E. NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I. The Journal Of Biological Chemistry. 2016;291(28):14851-60.