Anti COX5A pAb (ATL-HPA027526 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027526-100

• 
• 

Protein Description: cytochrome c oxidase subunit Va
Gene Name: COX5A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000088: 93%, ENSRNOG00000018816: 93%
Entrez Gene ID: 9377
Uniprot ID: P20674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGI
• Gene Sequence: QSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGI
• Gene ID - Mouse: ENSMUSG00000000088
• Gene ID - Rat: ENSRNOG00000018816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.