Anti COX4I1 pAb (ATL-HPA002485)

Atlas Antibodies

Catalog No.: ATL-HPA002485-25

Protein Description: cytochrome c oxidase subunit IV isoform 1
Gene Name: COX4I1
Alternative Gene Name: COX4, COX4-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031818: 79%, ENSRNOG00000017817: 81%
Entrez Gene ID: 1327
Uniprot ID: P13073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
• Gene Sequence: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
• Gene ID - Mouse: ENSMUSG00000031818
• Gene ID - Rat: ENSRNOG00000017817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COX4I1 pAb (ATL-HPA002485) – 2 Found

Rice, Matthew W; Smith, Kristen L; Roberts, Rosalinda C; Perez-Costas, Emma; Melendez-Ferro, Miguel. Assessment of cytochrome C oxidase dysfunction in the substantia nigra/ventral tegmental area in schizophrenia. Plos One. 9(6):e100054. 

Aizarani, Nadim; Saviano, Antonio; Sagar; Mailly, Laurent; Durand, Sarah; Herman, Josip S; Pessaux, Patrick; Baumert, Thomas F; Grün, Dominic. A human liver cell atlas reveals heterogeneity and epithelial progenitors. Nature. 2019;572(7768):199-204.