Anti COX15 pAb (ATL-HPA066096)

Atlas Antibodies

Catalog No.: ATL-HPA066096-25

Protein Description: cytochrome c oxidase assembly homolog 15 (yeast)
Gene Name: COX15
Alternative Gene Name: CEMCOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040018: 90%, ENSRNOG00000017230: 93%
Entrez Gene ID: 1355
Uniprot ID: Q7KZN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGESWIPEDLFTFSPILRNVFENPTMVQFD
• Gene Sequence: MGESWIPEDLFTFSPILRNVFENPTMVQFD
• Gene ID - Mouse: ENSMUSG00000040018
• Gene ID - Rat: ENSRNOG00000017230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.