Anti COQ8B pAb (ATL-HPA027279 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027279-25

• 
• 

Protein Description: coenzyme Q8B
Gene Name: COQ8B
Alternative Gene Name: ADCK4, COQ8, FLJ12229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003762: 93%, ENSRNOG00000020848: 90%
Entrez Gene ID: 79934
Uniprot ID: Q96D53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
• Gene Sequence: RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
• Gene ID - Mouse: ENSMUSG00000003762
• Gene ID - Rat: ENSRNOG00000020848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.