Anti COQ3 pAb (ATL-HPA031273 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031273-25

Protein Description: coenzyme Q3 methyltransferase
Gene Name: COQ3
Alternative Gene Name: bA9819.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028247: 86%, ENSRNOG00000009974: 89%
Entrez Gene ID: 51805
Uniprot ID: Q9NZJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
• Gene Sequence: KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
• Gene ID - Mouse: ENSMUSG00000028247
• Gene ID - Rat: ENSRNOG00000009974
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.