Anti COL9A1 pAb (ATL-HPA074749)

Atlas Antibodies

Catalog No.: ATL-HPA074749-25

Protein Description: collagen type IX alpha 1 chain
Gene Name: COL9A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026147: 93%, ENSRNOG00000012920: 92%
Entrez Gene ID: 1297
Uniprot ID: P20849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
• Gene Sequence: PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
• Gene ID - Mouse: ENSMUSG00000026147
• Gene ID - Rat: ENSRNOG00000012920
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.