Anti COL6A2 pAb (ATL-HPA038799 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038799-25

Protein Description: collagen, type VI, alpha 2
Gene Name: COL6A2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020241: 86%, ENSRNOG00000001254: 86%
Entrez Gene ID: 1292
Uniprot ID: P12110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR
• Gene Sequence: ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR
• Gene ID - Mouse: ENSMUSG00000020241
• Gene ID - Rat: ENSRNOG00000001254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.