Anti COL20A1 pAb (ATL-HPA051962)

Atlas Antibodies

Catalog No.: ATL-HPA051962-25

Protein Description: collagen, type XX, alpha 1
Gene Name: COL20A1
Alternative Gene Name: KIAA1510
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016356: 79%, ENSRNOG00000010326: 78%
Entrez Gene ID: 57642
Uniprot ID: Q9P218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVSAIYAAGRSEAVSATGQTACPALRPDGSLPGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPA
• Gene Sequence: LVSAIYAAGRSEAVSATGQTACPALRPDGSLPGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPA
• Gene ID - Mouse: ENSMUSG00000016356
• Gene ID - Rat: ENSRNOG00000010326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.