Anti COL18A1 pAb (ATL-HPA036104)

Atlas Antibodies

Catalog No.: ATL-HPA036104-25

Protein Description: collagen, type XVIII, alpha 1
Gene Name: COL18A1
Alternative Gene Name: KNO, KNO1, KS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001435: 78%, ENSRNOG00000001229: 78%
Entrez Gene ID: 80781
Uniprot ID: P39060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVAALQPPVVQLHDSN
• Gene Sequence: VRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVAALQPPVVQLHDSN
• Gene ID - Mouse: ENSMUSG00000001435
• Gene ID - Rat: ENSRNOG00000001229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.