Anti COL12A1 pAb (ATL-HPA010021)

Atlas Antibodies

SKU: ATL-HPA010021-25

• 

Protein Description: collagen type XII alpha 1 chain
Gene Name: COL12A1
Alternative Gene Name: COL12A1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032332: 86%, ENSRNOG00000058470: 86%
Entrez Gene ID: 1303
Uniprot ID: Q99715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
• Gene Sequence: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
• Gene ID - Mouse: ENSMUSG00000032332
• Gene ID - Rat: ENSRNOG00000058470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.