Anti CNR1 pAb (ATL-HPA069945)

Atlas Antibodies

Catalog No.: ATL-HPA069945-25

Protein Description: cannabinoid receptor 1
Gene Name: CNR1
Alternative Gene Name: CANN6, CB-R, CB1, CB1A, CB1K5, CNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044288: 100%, ENSRNOG00000008223: 100%
Entrez Gene ID: 1268
Uniprot ID: P21554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT
• Gene Sequence: LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT
• Gene ID - Mouse: ENSMUSG00000044288
• Gene ID - Rat: ENSRNOG00000008223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.