Anti CNP pAb (ATL-HPA023266 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023266-100

Protein Description: 2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 90%, ENSRNOG00000017496: 90%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG
• Gene Sequence: ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG
• Gene ID - Mouse: ENSMUSG00000006782
• Gene ID - Rat: ENSRNOG00000017496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) – 2 Found

Wüthrich, Christian; Batson, Stephanie; Anderson, Matthew P; White, Lon R; Koralnik, Igor J. JC Virus Infects Neurons and Glial Cells in the Hippocampus. Journal Of Neuropathology And Experimental Neurology. 2016;75(8):712-717. 

Peluffo, Hugo; Alí-Ruiz, Daniela; Ejarque-Ortíz, Aroa; Heras-Alvarez, Victor; Comas-Casellas, Emma; Martínez-Barriocanal, Agueda; Kamaid, Andres; Alvarez-Errico, Damiana; Negro, Maria Luciana; Lago, Natalia; Schwartz, Simó Jr; Villaverde, Antonio; Sayós, Joan. Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury. Brain Pathology (Zurich, Switzerland). 2012;22(3):318-28.