Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073283-25

• 
• 

Protein Description: carnosine dipeptidase 1
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 78%, ENSRNOG00000027739: 82%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
• Gene Sequence: RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
• Gene ID - Mouse: ENSMUSG00000056162
• Gene ID - Rat: ENSRNOG00000027739
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.