Anti CNBD1 pAb (ATL-HPA027786)

Atlas Antibodies

Catalog No.: ATL-HPA027786-25

Protein Description: cyclic nucleotide binding domain containing 1
Gene Name: CNBD1
Alternative Gene Name: FLJ35802
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073991: 53%, ENSRNOG00000056330: 57%
Entrez Gene ID: 168975
Uniprot ID: Q8NA66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKW
• Gene Sequence: AEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKW
• Gene ID - Mouse: ENSMUSG00000073991
• Gene ID - Rat: ENSRNOG00000056330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.